Scaffold Ga0181537_10072774

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181537_10072774

Scaffold Ga0181537_10072774

Overview

Basic Information
Taxon OID	3300014201 Open in IMG/M
Scaffold ID	Ga0181537_10072774 Open in IMG/M
Source Dataset Name	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2331
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	47.1149	Long. (^o)	-88.5476	Alt. (m)		Depth (m)	.1 to .2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046773	Metagenome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181537_100727743	F046773	AGGA	MPPFNQFFIQATLILACLLICLAFSTLRAFLTAAAVLGAIGGDSWEFHRYGCNEMPTIIYLLIPAAVILTCVLIYLASTNIRGFLVLASFLAAIAAACWLLNALAPAVGILLVIWFILRGFRNSTGGGSLFKAFVVHSGVPDISVGEAYMASEADLI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.