NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134346_1000529

Scaffold Ga0134346_1000529


Overview

Basic Information
Taxon OID3300014293 Open in IMG/M
Scaffold IDGa0134346_1000529 Open in IMG/M
Source Dataset NameHuman oral microbial communities of schizophrenia patients from Maryland, USA - ES_107
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe George Washington University (GWU)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14466
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (90.91%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Source Dataset Sampling Location
Location NameUSA: Maryland
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084362Metagenome112N

Sequences

Protein IDFamilyRBSSequence
Ga0134346_10005297F084362GGAGGMSLMNCTFTVRWSDDKNKPHAKTYDTEDDAKRAKKWLLEHGVRSVDIAVKINNKPAGSLKDDKQSETEAEQKGFWWEK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.