Basic Information | |
---|---|
Taxon OID | 3300014487 Open in IMG/M |
Scaffold ID | Ga0182000_10545841 Open in IMG/M |
Source Dataset Name | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 549 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico: Magueyal, Guanajuato | |||||||
Coordinates | Lat. (o) | 21.195 | Long. (o) | -100.439 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027428 | Metagenome | 194 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182000_105458412 | F027428 | N/A | AAAVLFIAGPIMGLVFWSWGLGAVVFGAGAIVLGIRQVLLGDNRGERFLGVALLLGGAFTVLEGLIRLLLGASP* |
⦗Top⦘ |