NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182018_10135149

Scaffold Ga0182018_10135149


Overview

Basic Information
Taxon OID3300014489 Open in IMG/M
Scaffold IDGa0182018_10135149 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1418
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000451Metagenome / Metatranscriptome1124Y
F075570Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0182018_101351493F000451AGGMPRFQTVIKHARFVYSPYTATEMQGFAQVLTDAIRARIQHGQNIYDQAAAPLKPGLPGRRGYPDYKAARGLNPIRDWTWSGHTLRCLKVLTANENRAAIGFLDESLPGRRQTASQIAAFNNRREAQWGVSPRDRQAVLAAFQARPFVMLKAA*
Ga0182018_101351494F075570AGGMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.