NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182010_10001559

Scaffold Ga0182010_10001559


Overview

Basic Information
Taxon OID3300014490 Open in IMG/M
Scaffold IDGa0182010_10001559 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12026
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000780Metagenome / Metatranscriptome895Y
F008261Metagenome / Metatranscriptome336Y
F021136Metagenome / Metatranscriptome220Y

Sequences

Protein IDFamilyRBSSequence
Ga0182010_1000155910F000780GGCGGMDSPTESAKAKIGAKLPYRSGHLMCRTPLWGVAGFLGCAYFAWISFSHVTRHEYEWPHDAWTTATYIVWILLLAGLALDTRCLRERLFFGVLVVNFVVGCGLTLWRNVPPADVRTARIGTGALWGLAALMSLTTLERAVDSRRNS*
Ga0182010_1000155912F021136N/AHILLLLLGLGIASRAIPTQLVSNMLGYLHKTIGITTPSAQQVRMVALIWIGSTVIIVDGCILLLLFIASVSNSG*
Ga0182010_100015594F008261GGAGMKLWHLCYAALGIAVARWVFKRQPMQVTDPISRFRASGLL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.