NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182014_10012685

Scaffold Ga0182014_10012685


Overview

Basic Information
Taxon OID3300014491 Open in IMG/M
Scaffold IDGa0182014_10012685 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8000
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016549Metagenome / Metatranscriptome246Y
F031304Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Ga0182014_100126854F031304AGGAMNGECSRCTRPLTVENASKVVARTGIGRCRSCENEHTKGRSRTLGGRYTLGRSQAKFNKHKWELSFQQYAAIVASGRCFYCGNPLPTAAAGLDRKENEDYTWDTVFPCCGKQPRASGPRGCNETKSHEIAPILLFVRRWYEKSGKLPTEQDYLDSVRQFEAERDTAFEIISKLGAGEVKKLKRAKSISEGLATLMRAAPTPTSETLGLLNS*
Ga0182014_100126859F016549GAGGMATGAVNRKSDESAVEAHKAVSGEKTYSLGQLAEHRALMDRVLEEGGKRIRRSVDRLIAMGFYDKDGNRLKKELPADMQPGADRDFGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.