NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182017_10399572

Scaffold Ga0182017_10399572


Overview

Basic Information
Taxon OID3300014494 Open in IMG/M
Scaffold IDGa0182017_10399572 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)851
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003186Metagenome / Metatranscriptome502N
F010139Metagenome / Metatranscriptome308Y

Sequences

Protein IDFamilyRBSSequence
Ga0182017_103995721F003186N/ATAIGGDGNNIRAFMEGLATDNNLRLAILQMPPGSLLVAWNGTTPRRLTGGALHFAHRFAIYLRAPEQESTATYADLFWLLVSARPTGAPSWESLLHLQIDPDCYPMDMDLPSAQRNTVVVSADGATLDYFEVQATLVEQGNPGGE*
Ga0182017_103995722F010139AGGAGMNSIFMRSPEGEVREVEATTAALTPLMVSGWIQVPPPAAGQKPATPAKEEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.