NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182024_10000172

Scaffold Ga0182024_10000172


Overview

Basic Information
Taxon OID3300014501 Open in IMG/M
Scaffold IDGa0182024_10000172 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)150700
Total Scaffold Genes136 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)93 (68.38%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048525Metagenome / Metatranscriptome148Y
F075256Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0182024_10000172100F048525AGGAMRNQCLRIFIALIGVAGLGMAVKGQTVDQIVLKVPYDFVVAGKTLPAGTYRVNRLRDADPDVLILSSFENRASAIVLPTTHVDSSGDKVQVSFEQVGGDHFLSKIETADHVFTIPVSHSEILEAAARSHGGTSPSGASAGN*
Ga0182024_10000172118F075256GAGMFGVMLFAISVVALSQFALYYWRAVLTAVACQPVSDNVLAAANIENGRVTGRDFQTLSGLHDLTLELTPSTNGLGLVRLYYRVVDRLATVAGQRLPAISAWCEQELTVCARYAAVQIECRLRSNLELAASMRSC*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.