NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182024_10463290

Scaffold Ga0182024_10463290


Overview

Basic Information
Taxon OID3300014501 Open in IMG/M
Scaffold IDGa0182024_10463290 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1622
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018570Metagenome / Metatranscriptome234Y

Sequences

Protein IDFamilyRBSSequence
Ga0182024_104632901F018570AGGAGMSHKLQIILPDPVALQLRELAAGADTPPSTLAAQIVRTGVALAATDGKVRPLRPAPVLVGDNDSGRAPWLEPYGGDDEWRQHMWGAIVALHGRYPIQLQSLQDGWWTDDSQTETLCALAVWRAELDDAGQDPREELAFQNQLADYSQTLQRQGGGVTKAWTPGP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.