NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181519_10368012

Scaffold Ga0181519_10368012


Overview

Basic Information
Taxon OID3300014658 Open in IMG/M
Scaffold IDGa0181519_10368012 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)889
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000451Metagenome / Metatranscriptome1124Y
F018347Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0181519_103680121F018347AGGMADQAERVILEAEDQVSPVVDKANAGLDSFEKKAESSHSKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRDQLLQRYNREPQAIDAITRSYEKMIAAEEKVAREALAVKAAKEAEEALRKQAESITSFGERVSQSMEN
Ga0181519_103680122F000451N/AQTVIRRARFVYSPYTATEMQGFAQVLADSIRARIQSGRNIYDQAAAPLKPGLAGRRGYPDYKAARGLKPIRDWTWSGHTLRCLKVLTANENRAAIGFLDESLPGRRMTASQIAAFNNRREAQWGVSPRDRQAVLAAFQARPFVMLKAA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.