Scaffold Ga0172376

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172376_10559001

Overview

Basic Information
Taxon OID	3300014720 Open in IMG/M
Scaffold ID	Ga0172376_10559001 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Restricted
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components
Scaffold Length (bps)	632
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location Name	Congo: South-Kivu
Coordinates	Lat. (^o)	-1.64	Long. (^o)	29.05	Alt. (m)	Depth (m)	35
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004305	Metagenome / Metatranscriptome	444	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172376_105590012	F004305	GGAGG	MATTEKDEQSEIVKQHHRMAAGAWVTGSELKEQGSATMPEANSDHGNFSGKGIDKSNA*

⦗Top⦘

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.