Scaffold Ga0134404_102709

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134404_102709

Scaffold Ga0134404_102709

Overview

Basic Information
Taxon OID	3300014769 Open in IMG/M
Scaffold ID	Ga0134404_102709 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from obese patients in Germany - AS43_18
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hohenheim
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4188
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location
Location Name	Germany
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088914	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134404_1027091	F088914	N/A	VLYHLTAAVGRILPVCSGFFVFWSRKEGANYQISVKSFSNLDSYDIIQLYIMTELTDGRVSDRLFSVPYTPKENIKNPGKFIVFSAWYAAKALEMDVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.