Scaffold Ga0169781_102568

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0169781_102568

Scaffold Ga0169781_102568

Overview

Basic Information
Taxon OID	3300014771 Open in IMG/M
Scaffold ID	Ga0169781_102568 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from infant at 12 months in Denmark - 566_12M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8220
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → unclassified Collinsella → Collinsella sp. 4_8_47FAA	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location
Location Name	Denmark
Coordinates	Lat. (^o)	55.678	Long. (^o)	12.531	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099269	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0169781_1025681	F099269	GAG	VRELLLLDDLGDRASGASVLASATGDAGVLVSDGGDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCASV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.