Scaffold Ga0119954_1044998

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119954_1044998

Scaffold Ga0119954_1044998

Overview

Basic Information
Taxon OID	3300014819 Open in IMG/M
Scaffold ID	Ga0119954_1044998 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	777
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	34.21	Long. (^o)	-83.96	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035329	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119954_10449981	F035329	AGG	MATRKAIALISGYFQEVNTPTDKLDFAGNTTTDLAEGTN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.