 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300014839 Open in IMG/M |
| Scaffold ID | Ga0182027_10113709 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3240 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Kiritimatiellota → Kiritimatiellia → Kiritimatiellales → Pontiellaceae → Pontiella → Pontiella sulfatireligans | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Stordalen | |||||||
| Coordinates | Lat. (o) | 68.35 | Long. (o) | 19.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028497 | Metagenome | 191 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182027_101137092 | F028497 | GAG | MQIKVLVIDKVSETFDTKKGSKTLHLLVCQDQSRPPLRNSFDYEMTADELTKHGASLVDKTVELNIRDMSQNFAGRMRMSGAIMRVVA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |