NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182027_10266453

Scaffold Ga0182027_10266453


Overview

Basic Information
Taxon OID3300014839 Open in IMG/M
Scaffold IDGa0182027_10266453 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1952
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030458Metagenome185Y
F041367Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0182027_102664532F030458GAGGMPFQPKITRARWVLGPFTAEDMQTIGTVLVDSISARIRKAVNVSDAEARPLKPGRNGHRGYPDYKAARGLQPFRDWFWTGRTMRSLKVKSASENRVVIGFVDPNADRIAHVNNLRERQFGVSPRDRLALNAIVLAVLKQARVVRVAKAA*
Ga0182027_102664534F041367N/ALIHRSVRACELCDGGADGPRGCPDANDVACGKCGVVRTVEDTNAPGACPQCGGWQFMVNRCAHCKLDDLDYARTHSNAGRLFERLLELEFDAAHFSIPWSDVTAEEVRGLQILKEERERYQREQSQKPPIV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.