Basic Information | |
---|---|
Taxon OID | 3300014913 Open in IMG/M |
Scaffold ID | Ga0164310_10756300 Open in IMG/M |
Source Dataset Name | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 554 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mexico: Gulf of California | |||||||
Coordinates | Lat. (o) | 27.0151 | Long. (o) | -111.3798 | Alt. (m) | Depth (m) | 2000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036512 | Metagenome | 169 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0164310_107563001 | F036512 | N/A | DKEYFAKRAETLSRALAKSINLPEPPNPSKEMEEVNPWKFIAKYGKYDILTADKYYYTLPLNTWIKILSSIQTQVEKILPKWRVDVADCDDYALLMASFVAAVFAKPYYDKQVAFAITWSRSHAYNSFITSEGTWEIYEPQSNAIVGRLGKTTGTYKTEKIWFMG* |
⦗Top⦘ |