NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134385_102184

Scaffold Ga0134385_102184


Overview

Basic Information
Taxon OID3300014941 Open in IMG/M
Scaffold IDGa0134385_102184 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from obese patients in Germany - AS63_0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hohenheim
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4372
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location
Location NameGermany
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055775Metagenome138N

Sequences

Protein IDFamilyRBSSequence
Ga0134385_1021845F055775N/AMAQIAQQDNLVIEVTTTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIINANSKTVEAIALN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.