Basic Information | |
---|---|
Taxon OID | 3300014957 Open in IMG/M |
Scaffold ID | Ga0119942_1021341 Open in IMG/M |
Source Dataset Name | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Disinfected water - DW |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Nanjing University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 695 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment System In Nanjing, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Nanjing | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .02 | Location on Map | ||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084131 | Metagenome / Metatranscriptome | 112 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119942_10213412 | F084131 | N/A | EPVRVGDTVLGRPELKAILRNAEKTLDDDIPARAQFLTQKQQAQKLAHQMFPYLKNKETPEYVLAQQALSQMPWMRNLPNADWIIGVQIEGLKALEAKQKAKPESKPKPAMSSKPPASQSVVSSAGGDVRAPSATKAANQIEALRMQLSKKGGVTANEAAAFLLAREKAKLNR* |
⦗Top⦘ |