NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119942_1023772

Scaffold Ga0119942_1023772


Overview

Basic Information
Taxon OID3300014957 Open in IMG/M
Scaffold IDGa0119942_1023772 Open in IMG/M
Source Dataset NameAquatic microbial communities from drinking water treatment system in Nanjing, China - Disinfected water - DW
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNanjing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)651
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment System In Nanjing, China

Source Dataset Sampling Location
Location NameChina: Nanjing
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m).02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019992Metagenome / Metatranscriptome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0119942_10237721F019992N/AQSTIVQANNYVYIFRGDDAKPLYWDGDWNGSFAEVPDTTLPASFNSIPNSNQATYYQNRLWVVKGKDGLAASDVLEFTDYDPLANEFNLNTGNSDYIVATYPFGQNSLVAFKNKSILLLQNVEGSLSDVTVTEVTRQVGVVGINSVTSIGPDLAYVSNRNINLLTLTNTNNSLQHKTLPLSTKIRAIMRRVNWQYGYKISLGYWNNKLYVALPLDN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.