Scaffold Ga0134523_1018562

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134523_1018562

Scaffold Ga0134523_1018562

Overview

Basic Information
Taxon OID	3300014963 Open in IMG/M
Scaffold ID	Ga0134523_1018562 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from elderly subjects during probiotic consumption in Boston, USA - meta_42827d56
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland School of Medicine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3416
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Elderly Subjects During Probiotic Consumption In Boston, Usa

Source Dataset Sampling Location
Location Name	USA: Boston
Coordinates	Lat. (^o)	42.3601	Long. (^o)	-71.0589	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077319	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134523_10185623	F077319	GGAGG	MLIRNVTLQMSATERACMDVRVMNGCVWEMGAALVKGLYEAEIDLHGDVLMPGRMLETPVPAADEKTLRLLCRRLYREGVRDFVADCPADVLLRVQNRPERRGALPVTALPNPEPLRSGTGMPLTRWTAAGEFVGMMDEHSGD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.