Basic Information | |
---|---|
Taxon OID | 3300015089 Open in IMG/M |
Scaffold ID | Ga0167643_1046629 Open in IMG/M |
Source Dataset Name | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Bristol |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 662 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Russell glacier, Kangerlussuaq, Greenland | |||||||
Coordinates | Lat. (o) | 67.05702 | Long. (o) | -50.459796 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017695 | Metagenome / Metatranscriptome | 239 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0167643_10466291 | F017695 | N/A | LMQTIILSCVFGAVCTMVLWVVGSAAAKRDMMIRRGGKLLSPEEF* |
⦗Top⦘ |