 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300015158 Open in IMG/M |
| Scaffold ID | Ga0167622_1001083 Open in IMG/M |
| Source Dataset Name | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11378 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (70.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russell Glacier, Kangerlussuaq, Greenland | |||||||
| Coordinates | Lat. (o) | 67.15650902 | Long. (o) | -50.06398397 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010845 | Metagenome / Metatranscriptome | 298 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167622_10010838 | F010845 | N/A | MVACQKAEPLTAAKANQIIESYRFAAEPIYAEVPQKVFWNARFPKDEYDDRSLRTFDNLRNAGLITVTGGPSAEGAEYIAHVTAKGFPILGTSPSARGPVFRGLICYKVYDGLRNFQRHPTEPTTGQGELAWHYTRPTPLYPLFETKQNKPLDKTFVSLVSFYYKDHQYRFDVTVRKTE* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |