NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167628_1000446

Scaffold Ga0167628_1000446


Overview

Basic Information
Taxon OID3300015165 Open in IMG/M
Scaffold IDGa0167628_1000446 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3A, Proglacial river margin, by glacier terminus)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10182
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (83.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRussell Glacier, Kangerlussuaq, Greenland
CoordinatesLat. (o)67.152116Long. (o)-50.048697Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067309Metagenome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0167628_10004461F067309AGGAMSHIIGRPDDDLLDVMLGHGADPEQAFIGGSEQGLEEGDGFEDRVRADEPTVAEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.