Basic Information | |
---|---|
Taxon OID | 3300015167 Open in IMG/M |
Scaffold ID | Ga0167661_1002663 Open in IMG/M |
Source Dataset Name | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Bristol |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3198 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Storglaci?ren, Tarfala, Sweden | |||||||
Coordinates | Lat. (o) | 67.904687 | Long. (o) | 18.610965 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F009712 | Metagenome | 314 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0167661_10026636 | F009712 | N/A | MSALLGRLFQLIGMIILPIGLLTGLLKDNVTMEVRLLFIGGAFFLI |
⦗Top⦘ |