NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167661_1050504

Scaffold Ga0167661_1050504


Overview

Basic Information
Taxon OID3300015167 Open in IMG/M
Scaffold IDGa0167661_1050504 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)780
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameStorglaci?ren, Tarfala, Sweden
CoordinatesLat. (o)67.904687Long. (o)18.610965Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099780Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0167661_10505041F099780N/ASHFRLGVVYLQMAPPQGNDGFWELAKSIGLKSPNGPNEAQVRTYMKNQLTRYQQPACDKLVDDQVNELVTVASTADERPATLNIPSVADLQKARDDTANFIPALKGGGDAGKMMWLASCGLEYPDVGVRVMEAPQVEGENVNLKVFRGSTPEEIEAATESNMLVKVAGQPEAKKLDKDAVVRFTGTLTGYTQSPFLLTWEKAKINPEDLPDEKAGPAKKGPAKKAPAKKAP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.