NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167667_1018161

Scaffold Ga0167667_1018161


Overview

Basic Information
Taxon OID3300015189 Open in IMG/M
Scaffold IDGa0167667_1018161 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1978
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRabots glacier, Tarfala, Sweden
CoordinatesLat. (o)67.906846Long. (o)18.44555Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093312Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0167667_10181613F093312N/AMTLKQSSAVHIQALYSADAILLGSSSKLRLLVINLASVPGRSAVGQFPTAQSLERWWQRQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.