NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167663_1076210

Scaffold Ga0167663_1076210


Overview

Basic Information
Taxon OID3300015202 Open in IMG/M
Scaffold IDGa0167663_1076210 Open in IMG/M
Source Dataset NameArctic sediment microbial communities from supraglacial cryoconite, Storglaci?ren, Tarfala, Sweden (Sample st-12a, ablation zone cryoconite)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)996
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameStorglaci?ren, Tarfala, Sweden
CoordinatesLat. (o)67.901457Long. (o)18.580979Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050419Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0167663_10762102F050419GGAGGMTNASRSTFLRHFGRKKTARRAPDLADMGTAFALDEALERGDGETLVAGNSPSPMRSAIRVAPWRLWLGRKLG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.