Scaffold Ga0172382_11135955

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172382_11135955

Scaffold Ga0172382_11135955

Overview

Basic Information
Taxon OID	3300015214 Open in IMG/M
Scaffold ID	Ga0172382_11135955 Open in IMG/M
Source Dataset Name	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	510
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location
Location Name	Canada: Ontario
Coordinates	Lat. (^o)	43.442	Long. (^o)	-80.577	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039402	Metagenome / Metatranscriptome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172382_111359551	F039402	AGGAG	MALTDYSMMEREIEDAPEPKTLPRGAEVKARIIAVREGVSDKNDAHWYQPVFDVPADITVKEFNAFFWDLVDIDKLEGGRAGKQALGAMRGFKNFASCFNIDYSRPFDWLEDLIGKEGWVILG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.