NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0132258_10079688

Scaffold Ga0132258_10079688


Overview

Basic Information
Taxon OID3300015371 Open in IMG/M
Scaffold IDGa0132258_10079688 Open in IMG/M
Source Dataset NameCombined assembly of cpr5 and col0 rhizosphere and soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7634
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location NameUniversity of North Carolina
CoordinatesLat. (o)35.9Long. (o)-79.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004065Metagenome / Metatranscriptome455Y
F008460Metagenome / Metatranscriptome333Y
F008765Metagenome / Metatranscriptome328Y
F076735Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0132258_100796881F004065GGALPTKGSAYRAEGNPTLRTVCANCGKSIPTEAGHAHPLDEDLRRETWGLVGYQEGQKTVFPTCTACHDAGWRPPDFVWMN*
Ga0132258_100796882F008460AGGAGMAVDNADDLVPFQDVRVIRSEAPALLCRVAERNVWLPRRHIAGKLWCTGDRGKLFIRRWVARDRHLIDLHGMAIVSPVRSISPPIGPVRLRLVRRDRDTHLAD*
Ga0132258_100796883F076735GGAGGMESFQRGFRAATPVRRHVSVFVVGRRVYVASSGDRPAHVALTDDVGANARTRLAGGTEVEILAWRPRGSGGTRYRVRSTRDGLEGWLAVDNLRSTRSAVSAPAEPLTSATGSGPLRAAESGDSGRQFGRRRY*
Ga0132258_100796884F008765AGGMTPTHEKPMSERERAEEKVRAIVEEFDRPTLALLYRTLHDALGLRIETADIAIGKLRR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.