NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182033_10143237

Scaffold Ga0182033_10143237


Overview

Basic Information
Taxon OID3300016319 Open in IMG/M
Scaffold IDGa0182033_10143237 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1833
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000702Metagenome / Metatranscriptome929Y
F017407Metagenome / Metatranscriptome241Y
F031974Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0182033_101432371F031974N/ADKINVEWTRPATLHNGAVSTDFPTLRDAIIAWHRLRPEQAQRASIRIIGGELYAAREIAKLLNGSRSQGA
Ga0182033_101432373F000702AGGAGMRKVLRGFAKNKDGNLVLVGTIPAPHSKDKRSPRERQDKRHLVRQGATIFKKEVAR
Ga0182033_101432374F017407GGAMGRLGLYAALALCVYGLPATAGERFGKWSLEQPGDFVFALSFKRSLSSDDRTATSELAFVCNQEEKYVAVLLIPLDGTFKNRQNSIPVVVQRTEEQSDTTDLMQRWENGPRYIFLESPDEQEQLASYLKDREVEGVKSVHFYFPNDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.