NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182035_10245260

Scaffold Ga0182035_10245260


Overview

Basic Information
Taxon OID3300016341 Open in IMG/M
Scaffold IDGa0182035_10245260 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1443
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000284Metagenome / Metatranscriptome1378Y
F081676Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0182035_102452601F000284AGGAMTAFPVWLVRFAPRALVATIALLCLSSTVLAHDIYTNIRNRDGQLCCNGQDCKPVQATVLPNGSYYLPASDEIIPSEMATPSPDDRFHRCTYSPVPNEFDTLNLLVTKFKRRCFFASMH
Ga0182035_102452602F081676GAGGMLLRISMAAFAATIFLGLWSETCAATELNVPPTASTDIDWWQKDLTVVVIAPDGTWGVATDPITGRAIANAMADCKNKYQSKIGCGSQMTFVRGGWSIGKRCGDRNIFVAEETLAKAEQATINRETELRKVYAPDMPPCVRVMSVDPNGNVIAPDVADLLRIVMERQDVVSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.