NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182076_1554461

Scaffold Ga0182076_1554461


Overview

Basic Information
Taxon OID3300016739 Open in IMG/M
Scaffold IDGa0182076_1554461 Open in IMG/M
Source Dataset NameMetatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1616
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017488Metagenome / Metatranscriptome240Y
F030452Metagenome / Metatranscriptome185Y

Sequences

Protein IDFamilyRBSSequence
Ga0182076_15544612F017488GAGGMAFITDGGGNVLSFAEYTDLLQKDQRLLESNIIKIPAESGFADVTEFLEDILEKSTDRILLKLKASTWWQSYNSYVGNPITNLNALPNVNPNLIDPANKLNRRQQFTDLCVYYAFAQYVLPLIADFGNPESEEVSKIQYYDAKFNDLFNELIAIADWYDYDNSGTVDADEKAITYARTRRTRSRRSIVQVR
Ga0182076_15544614F030452AGGAGMAGVINVTSGSQAILTLGNTSALAQPGAAGGLAVPLVQDLSLNTSPGTVRYSTLDSTASSAFTTVVENSVSLNMLLDDDVFFGLSNTTNSVANDGLWTTSNNKNEIFFSVAFEGADSGDYYISGKGFIGGLAPSASIDQAVWISPMEITVNGDLTKSTV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.