NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181505_10645446

Scaffold Ga0181505_10645446


Overview

Basic Information
Taxon OID3300016750 Open in IMG/M
Scaffold IDGa0181505_10645446 Open in IMG/M
Source Dataset NameMetatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1380
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).3 to .4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005213Metagenome / Metatranscriptome408N
F019896Metagenome / Metatranscriptome227Y
F025071Metagenome / Metatranscriptome203N

Sequences

Protein IDFamilyRBSSequence
Ga0181505_106454461F019896N/AQTLRAGPPAVVSLTGLKFDRSLWAFQNAQLGVEYASRLKTYDAPIPVKIRQCEPGVAEVGPGEARIGLIALQLPPVSPDAKKTQPTVLKILFPIDRAGNLTATLVL
Ga0181505_106454463F005213AGGAGMASSATKMANEPEGAGEERQPDVQLQDVLFSALASSVCYWTTIFLLAIVGAYLIQWWLTHPGPYPALANDPWGITTPPWLILPLAPIGVVGSLGHAVWCALQGQRKWKMLMTAASLVAVMGCGKVLEIYLALM
Ga0181505_106454464F025071GAGGMIQHSENSRREMTNAEAGVVGAVLGFGLIALLLYLAVDRYHIRKEQLVEAGLYLFVIAAAIIAPVLRKFTTRGKRSKRPPFVIPARKDERAIESAWNQNAVLLGYD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.