NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186387_15832

Scaffold Ga0186387_15832


Overview

Basic Information
Taxon OID3300016835 Open in IMG/M
Scaffold IDGa0186387_15832 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Mediterranean Sea in L1 medium w/o silica, 20 C, 35 psu salinity and 676 ?mol photons light - Bathycoccus prasinos BCC 99000 (MMETSP0933)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)662
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)3.6Long. (o)43.4Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080815Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0186387_158321F080815N/ALSNSRDEALIALKASGACTSSSIGSAETCEAFVDNLREMQSVPTLMHVNVTEIFKDASSFSSVSLLLDREKKYYERTKCAPVLSTVTSWCRDNVRNCATVSDVYSGATVGTTLDYLSPLKQGGVTNIDEIFNKTFSPRGGLLLLGGEEKRTAEAKRLQDSVVYLAVLVGSFFALAGVARFFRSRKSREVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.