Scaffold Ga0186413_103375

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186413_103375

Scaffold Ga0186413_103375

Overview

Basic Information
Taxon OID	3300016849 Open in IMG/M
Scaffold ID	Ga0186413_103375 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic communities from Indian Ocean in L1 medium with seawater, 24 C, 33 psu salinity and 573 ?mol photons light - Bathycoccus prasinos RCC 716 (MMETSP1460)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	National Center for Genome Resources
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1594
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name	Indian Ocean
Coordinates	Lat. (^o)	-14.483333	Long. (^o)	113.45	Alt. (m)		Depth (m)	70
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089782	Metagenome / Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186413_1033751	F089782	N/A	MATLGSENKDESIAKNALQFSKKAPSGAFSAIDEQSATDSGLFLRELSEVSPQSVANPLLCDGVFVCSNVLEDHNASSSRKSHAFAILANMFVNDDVLSRTQLHKNKKLAKIAIEHLFSLDTTVDRPCLTEVARLLVAAGQKCKSMGYQWGELGDEMDDVWWLELLYDEDVQQRLKSIKELGENAATNRGGSVDELCGLIGDIELLTVNSPVGTMM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.