 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300017267 Open in IMG/M |
| Scaffold ID | Ga0186440_114457 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Gulf of California (Sea of Cort?s) in ASW medium, resuspended in ASW with 2.5 mg/L nocodazole, 20 C and 204 ?mol photons light - Extubocellulus spinifer CCMP 396 (MMETSP0699) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 783 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Ostreococcus → Ostreococcus mediterraneus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of California (Sea of Cort?s) | |||||||
| Coordinates | Lat. (o) | 31.3172 | Long. (o) | -113.56 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008555 | Metatranscriptome | 331 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186440_1144572 | F008555 | N/A | AANTAEVSTSDVRKGAAFDNIKASWGKSLNVGDFKTNLRCNYDYNENRDFLKDVNLQGNLMEGSGDDLQLAYDVKHNFKTKNTEVKLSATTQGTTLAAEYDTDSKLKEVSASRSVDVADYKVDLRPSWLVQAKTARVKMMSALGGNKDRISAQVDYNTDAGSAAYELGYSRSLEDGKEVSATFSPNDNELEVQYVDSKFENGATWTAKATVDTSDRNILEATKVTLKRAWSW |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |