NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186493_111448

Scaffold Ga0186493_111448


Overview

Basic Information
Taxon OID3300017326 Open in IMG/M
Scaffold IDGa0186493_111448 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Baffin Bay in L1 medium with seawater, 2 C, 33 psu salinity and 547 ?mol photons light - Polarella glacialis CCMP 2088 (MMETSP1440)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)961
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameAtlantic Ocean: Baffin Bay
CoordinatesLat. (o)78.5978Long. (o)-74.4992Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048097Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0186493_1114481F048097GGAGMAHGNFSDLVFLALFAVVVQWWAFPATLFEDLGPLKAQFSIKSADMDALIKFGGGMLLMIALTFSGVSWNEINGKMAGLGGFIAAGVTAYSTFKADSDVFVPRLFYVYALVLFLGALHIFAFPSNLKPPKNDSVKNNHGNFSDIIALGLIVASCLCYFYPDHLFQDTTFRALGKEFGPVKAQFSTKSADLTALIKFVAGLMLMIGLTFSSVKWNPDNGKMAGLGGFIAAGVIGHSTFNADSEVFVLRAFYIYAALLGLGALHIFAFPSNPRVRQEPKAKKA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.