NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186178_1054697

Scaffold Ga0186178_1054697


Overview

Basic Information
Taxon OID3300017341 Open in IMG/M
Scaffold IDGa0186178_1054697 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from unknown location in f/2 medium w/o silicate, at 15 C, 31 psu salinity and 422 ?mol photons light - Gymnodinium catenatum GC744 (MMETSP0784)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)546
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067800Metagenome / Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0186178_10546971F067800GAGMAAAMDKIMPVAGGLLGLWAASRVVPVMYRWDLIPGVASPEYQAKAARINYNHYTEGIVYSPYDTGDPITEMPAESRNKMLLKQKGGGLKLQSEM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.