NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186039_130931

Scaffold Ga0186039_130931


Overview

Basic Information
Taxon OID3300017342 Open in IMG/M
Scaffold IDGa0186039_130931 Open in IMG/M
Source Dataset NameMetatranscriptome of marine host-associated eukaryotic communities from unknown location in f/2 medium with natural seawater, 50% L1 mix, no silicate, at 26 C, 35 psu salinity and 387 ?mol photons light - Symbiodinium sp. cladeA (MMETSP1374)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)521
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071919Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0186039_1309311F071919GAGMDKEEKSVQQYKTIKRLQKNYLVRCNESLTNVIPGNGVKPVSEIRRLEKRITEKRAELGALTEQELLSQMDNSSQKKSAKSAQELAQRRMELTETIKQLEKELLEKELL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.