Basic Information | |
---|---|
Taxon OID | 3300017346 Open in IMG/M |
Scaffold ID | Ga0186040_133753 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine host-associated eukaryotic communities from unknown location in f/2 medium with natural seawater, 50% L1 mix, no silicate, at 26 C, 35 psu salinity and 361 ?mol photons light - Symbiodinium sp. C1 (MMETSP1367) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 596 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086596 | Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186040_1337531 | F086596 | N/A | WLSAPVSLWAPGNFSIREMAAVLLLVLPFLAAASPGLRGDGASSYVDSVQCSGSGALPENVCFSGSILKQTFDIEVVSYDGKVGTVNLKAEGSQSAQCDGAQFENQENAITIENDQGCGLSKYDYTVRYCPDQESLIVNLVKPFNVRVVLDSKSCTAGEV |
⦗Top⦘ |