 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300017357 Open in IMG/M |
| Scaffold ID | Ga0186038_127600 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine host-associated eukaryotic communities from unknown location in f/2 medium with natural seawater, 50% L1 mix, no silicate, at 29 C, 35 psu salinity and 369 ?mol photons light - Symbiodinium sp. C1 (MMETSP1369) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 706 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000665 | Metagenome / Metatranscriptome | 949 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186038_1276001 | F000665 | N/A | HEIDCTRIAMNPKFKGLEGSLGAVYYNFPHAGSVGGFFDGHPLVNWRHENLMRLFFRALRSFMKVGGLVKIASNMGAVGVRFSYITVGAKENEFDHVETVPFMEWKLHRYSRSYGDRRDVNRRPDQAQNYNAQRAEKDMVYVFKYNPSGEPLGPQTLRMPPSIATLLECQDGPFWSLPSMEVKKQLAKQLHDRFIKECSGRHVG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |