NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182196_1041149

Scaffold Ga0182196_1041149


Overview

Basic Information
Taxon OID3300017432 Open in IMG/M
Scaffold IDGa0182196_1041149 Open in IMG/M
Source Dataset NameSwitchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)793
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.39Long. (o)-85.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000661Metagenome / Metatranscriptome950Y
F017779Metagenome / Metatranscriptome238Y

Sequences

Protein IDFamilyRBSSequence
Ga0182196_10411491F000661N/AEFFATNPLDPLHWTLNSCFGAFRTIWVHLRPFGCLTKLGAKRFELVQKFVARRCVGGFRYEHTRSTPLDPKHMFWSVSYHLRAFGTIRLPYKTQGKTFRISAKVRATRSRQSFS
Ga0182196_10411492F017779GGAGMNPPDPPHWTLNYRFAAFRKIWVHLGPFGCLTKLGAKRAELVQKFVPRSCVRVFRDEHTRSTPLDTKLSFFCISYHLGAFGTVWLPYETRCKTG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.