Basic Information | |
---|---|
Taxon OID | 3300017469 Open in IMG/M |
Scaffold ID | Ga0187308_10033 Open in IMG/M |
Source Dataset Name | Hotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 4. Combined Assembly of Gp0212719, Gp0212720 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Stanford University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 10640 |
Total Scaffold Genes | 15 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → unclassified Archaeoglobales → Archaeoglobales archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hotspring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | YNP, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.428 | Long. (o) | -110.5885 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018963 | Metagenome / Metatranscriptome | 232 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187308_100333 | F018963 | GGAGG | LSRGSVGLDTLGDRPVGTKLMFPYVRGEDGSVTDTLIMSFRTKRVVYSKLSVNKYGHGYRTYVLLPANYVMYEAYRTGRGRASIKVSVIDVSPNPLSPFRVKDLWVMYEGVSPVTLIEDLPGNIRGIIEQNSGELPLYEYLETEVPK |
⦗Top⦘ |