NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187308_13895

Scaffold Ga0187308_13895


Overview

Basic Information
Taxon OID3300017469 Open in IMG/M
Scaffold IDGa0187308_13895 Open in IMG/M
Source Dataset NameHotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 4. Combined Assembly of Gp0212719, Gp0212720
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6900
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (53.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hotspring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location
Location NameYNP, Wyoming, USA
CoordinatesLat. (o)44.428Long. (o)-110.5885Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018029Metagenome / Metatranscriptome237Y
F075083Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0187308_1389511F018029AGGMNLSQIIEKKIRKDELNEEEMRDLMNYLNVLKEELQNLRIILYSPFGYIVDFDVVFNDPWYCSEVHLRLLNGEHGLLYLDSFIRRIFTDQIEVKPFISEVTHP
Ga0187308_138954F075083AGGMEIDVKEMPETESRKQIQKQKLIDSLRELDIDFEMGEDSVRIKGLAGSVCCGHMIVYQIPDTKIVFEEFGDANRIILNSTGTKPGIRKILLDKPVYVHYDFPYLIVQF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.