NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187308_14523

Scaffold Ga0187308_14523


Overview

Basic Information
Taxon OID3300017469 Open in IMG/M
Scaffold IDGa0187308_14523 Open in IMG/M
Source Dataset NameHotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 4. Combined Assembly of Gp0212719, Gp0212720
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5421
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hotspring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location
Location NameYNP, Wyoming, USA
CoordinatesLat. (o)44.428Long. (o)-110.5885Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035135Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0187308_145234F035135N/AMTYINEEFTTPIRQKRIHIIPHCIKYGQQFVSSFFFDVVDDEEYQYLIFTFLMKNAFKIYLNVWREQRKFISYLKTFKNEFKDAFDYYERLLITTKERIYQTTHIIACFFDFDRDIDEILTVYVNELFCNYVDDASR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.