 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300017649 Open in IMG/M |
| Scaffold ID | Ga0182741_1000391 Open in IMG/M |
| Source Dataset Name | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C BE-Lig OP (version 2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 67349 |
| Total Scaffold Genes | 58 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 55 (94.83%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Emeryville, California | |||||||
| Coordinates | Lat. (o) | 37.83 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011188 | Metagenome / Metatranscriptome | 294 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182741_10003917 | F011188 | GGAGG | VDTYNIYMDEMPTGEEYDGEEMVEVEFRVVPGSDDDGDPETNAVIAGLDLVDLINLRDALQQEIDDYALAALESEALRLAEAE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |