NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134112_10013230

Scaffold Ga0134112_10013230


Overview

Basic Information
Taxon OID3300017656 Open in IMG/M
Scaffold IDGa0134112_10013230 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2755
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: Angelo Coastal Reserve, California
CoordinatesLat. (o)39.7181Long. (o)-123.6527Alt. (m)Depth (m).4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004205Metagenome / Metatranscriptome448Y
F006201Metagenome / Metatranscriptome379Y

Sequences

Protein IDFamilyRBSSequence
Ga0134112_100132303F006201AGGAGGMHPEQKTLLTSALEALGPERVTRGLEATGHTWNDCFLAIALYGAPAALARQLQKRWRREHFVGTVLGVRMQVVNEVVRAWDHEEGTFRALAAEWLELNRAAVPTGPVVGAQCPRAVVARVLLS
Ga0134112_100132304F004205GGAGGMEARVTSQSQPFRLMERMEEARVFHGQELRADLPNVRVTALAGSREGQALFCNLGPIRVREIVHRGDEGPLPTNVTIEGLEVSISGTYDILNALVSANGDLRLVVDVKARVVPAARLVDAALGYRVAMGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.