NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187310_13892

Scaffold Ga0187310_13892


Overview

Basic Information
Taxon OID3300017696 Open in IMG/M
Scaffold IDGa0187310_13892 Open in IMG/M
Source Dataset NameHotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 6. Combined Assembly of Gp0212723, Gp0212724
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5750
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (76.47%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hotspring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location
Location NameYNP, Wyoming, USA
CoordinatesLat. (o)44.428Long. (o)-110.5885Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053392Metagenome / Metatranscriptome141N
F066921Metagenome126N

Sequences

Protein IDFamilyRBSSequence
Ga0187310_1389212F066921GGAMGEENTQVSPKAAYNRAVRAEEKAENALNEIASLKNSIDELVRTLKGAPSQPIQAQSLRPGQMIHTIISEDDEGITEEIVCPTCGTRELRKIPAKIEVKEKPVVPENYIPAPHSVSEAISLLETLHLPDGRTIFESDKFWSKLNEYAQKYVQNQKKR
Ga0187310_1389216F053392GAGGMMSVPSYVTLTGPQTTVMPASFTIAASAAAGTVVQGSILAFGPQSPAVAAPQVPITEVWSIVDIYIIGSVTPDALLSVYINGYPQDINPDLNSLNLNNLTRWKLMQALKLPPASTWFTTVTLMAANGSSQQVYTVYFSVIRAPYLPSGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.