NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187310_14374

Scaffold Ga0187310_14374


Overview

Basic Information
Taxon OID3300017696 Open in IMG/M
Scaffold IDGa0187310_14374 Open in IMG/M
Source Dataset NameHotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 6. Combined Assembly of Gp0212723, Gp0212724
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)37020
Total Scaffold Genes58 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (53.45%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hotspring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location
Location NameYNP, Wyoming, USA
CoordinatesLat. (o)44.428Long. (o)-110.5885Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101502Metagenome102N
F105516Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0187310_1437416F101502AGGMSQVPKAPIIAFTVILALGLGIVVIGASEPMKPGIGAVLVLLASIASAPLAYWLRHPGLIIIIELGVGVFLVIIIVNWLHGISPLTSLEWYYNALRTLIMPLARLKP
Ga0187310_1437417F105516N/AMPRAVVRVLALGRVSLNLKTFRVLALQRVSITSDGTVNCLGGDCSANGTFITLEADRPNARELYDALKKVRVLELEVEISGLPKWLLSRLEFLVGRPTGDKVRYTWHSMPSFGELALVLNDLNLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.